PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000440.1_g00024.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family Nin-like
Protein Properties Length: 940aa    MW: 104084 Da    PI: 6.6906
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000440.1_g00024.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.46.6e-29618668252
                   RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                              ek+isl++l++yF++++kdAA+++gvc+T+LKriCRq+GI RWP+Rkik++
  Itr_sc000440.1_g00024.1 618 EKTISLQVLRQYFAGSLKDAARSIGVCPTTLKRICRQHGITRWPSRKIKKV 668
                              799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.37607688IPR003035RWP-RK domain
PfamPF020422.1E-24620668IPR003035RWP-RK domain
SuperFamilySSF542773.68E-23830925No hitNo description
Gene3DG3DSA:3.10.20.2402.2E-23839920No hitNo description
SMARTSM006661.5E-28840923IPR000270PB1 domain
PROSITE profilePS5174525.219840923IPR000270PB1 domain
PfamPF005641.1E-18840921IPR000270PB1 domain
CDDcd064071.65E-43841921No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 940 aa     Download sequence    Send to blast
MGDGSSAPNP NHIFGTGSSS HDNNTVDITL MDELLLDGFW LETTEGSNFW QPAAPFTSPS  60
NPLDSPSSYF PTTSHSNTTA QFTPNQFHNH FPQQTTQNST FLHMEELDAE YQTNNPDSVP  120
PSSSSPNQPP TFMLQGTEMN NKRLWIGPNR SNPTPTASVK KRLVQAIEYL KESTRDKDVL  180
IQIWVPVNSR GRHVLTTNNQ PFFLNPNCKS LADYRHVSRN YQFAADNNSK ELVGLPGRVF  240
LNKLPEWTPD VRFFRREEYP RVTHAKQYNV SGSLALPVFE RGSGTCLGVV EIVTTFQKAN  300
YSPELQDVCK ALEAVDLRSS GVSSPLDEQI CNQSYQATLE EIQDVLKCVC DTHKLPMAQT  360
WAPCIQQGKG GCRHSDENYT SCVSTIESAC YVRVPQVLEF HQACSEHHLL KGEGVAGGAF  420
MTNQPCFATD VTAFSKTEYP LSHHARIFGL CAAVAIRLRS IHTGSADFVL EFFLPPDCKG  480
DEEQKQMLHS LSSVIEQICR TLRVVTDQEL AVETPFPDQE RGSPSAGGLD KEKSKKLVSP  540
PPRDPSQEAS SWFTHMMDAQ SKGKSTSVSF SNNKDELEEN FNLTTNWEKT DVEDSGPKES  600
ANSSGDFSSG AKRRTKTEKT ISLQVLRQYF AGSLKDAARS IGVCPTTLKR ICRQHGITRW  660
PSRKIKKVGH SLRKLQLVID SVQGAEGAIQ LSSFYSSFPE LGSQSLQGTS NYSASKMNDQ  720
LQQVTTQPEG ILPLSPGTTC SKSTSSCSHS SSSSFNCSAR ANQSPFTLNS SAGGDASSAE  780
QSGEMLKRAR SDAELHGLGQ EDTKLLVRSH SQKIISSHSF QETLAPLSNS TSHTLQNACT  840
FRVKATFGEE KIRFSLQPHW RFGDLQHEIL ARFNIQDGSK FDIKYLDDDS EWVLLTCDAD  900
LEECIDIHRS SKSRTIKLSL HYANNLKHGS SSGSRGEYLM
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016540054.10.0PREDICTED: protein NLP2
RefseqXP_016540055.10.0PREDICTED: protein NLP2
SwissprotQ7X9B90.0NLP2_ARATH; Protein NLP2
TrEMBLA0A0V0IVX10.0A0A0V0IVX1_SOLCH; Uncharacterized protein
STRINGVIT_03s0038g03710.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15982467
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein